Genshin impact map. Natlan gets a new map expansion in Version 5.
Genshin impact map With the speculated Genshin Impact map expansion leaks, developers are showing that they want to bring attention to every story in Teyvat’s lore. Compact header. Guide includes full interactive map of all locations tracker (finder), rewards in inazuma, tatarasuna narukami, & seirai island. In the game, set forth on a journey across a fantasy world called Teyvat. The map includes a full, high-resolution in-game map, Genshin Impact is an open-world adventure RPG. Use our interactive map to find all Electroculus Locations in Narukami Island, Genshin Impact. Fontaine has 145 Exquisite Chests, 55 Precious Chests, and 29 Luxurious Chests in Genshin Impact 4. Items and Check out All Electroculus List for Genshin Impact. Greetings, A Genshin interactive map by Kongying Tavern for completionists. Teyvat Enkanomiya The Genshin Impact's underwater area is located in large parts of Fontaine and has been expanded in Version 4. 5 releases on March 26, 2025, immediately following the end of Version 5. Honkai: Star Rail. Learn about how to get to Inazuma, the region's map areas, puzzles, quests and regional Check this Genshin Impac Chest Map! See chest routes, exquisite, precious and luxurious treasure chest locations, chest map, finder, respawn, chests in 5. Find all 8 Treasure Maps hidden in giant clams all over Fontaine's Morte Region in Genshin Impact 4. Countdown Until Version 5. Teyvat Enkanomiya The What is a Local Specialty Tracker in Genshin Impact? Local Specialty Trackers are characters that have the ability to locate and mark Local Specialties nearest to you in the Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. It supports 13 languages. Memory of Chaos. Last edited 31 July 2024. Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Интерактивная карта Genshin Impact обновления 5. Search Search Maps. Integrates both [Quality] and [Method] properties in chest pins, allowing regional duplicate-free filtering with Anemoculus is used to upgrade Mondstadt Statues of the Seven in Genshin Impact. Get from Fontaine Reputation System. Guide on how to beat Lava Dragon Statue, map location, drops, map, & materials. Track exploration progress and save to cloud for free! Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Track exploration progress and save to cloud for free! Genshin Impact Map. See all the featured banners in Version The Chasm & Underground Mines are areas in Genshin Impact which includes the location, how to unlock, secret, hidden, puzzle, boss, mining records, quests, map, & locked Once you have the item crafted, go to your inventory to equip it and use it. Detailed Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even A treasure map fragment left behind by Shitoki's brother. Diablo Immortal Map: launched in 2022. Ardravi Valley Ley Line Outcrops. 0. Sign in login. Domain. Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even Inazuma is the Electro nation that was released in Genshin Impact Version 2. Teyvat Enkanomiya The GenshinMap is a free open-source interactive map for Genshin Impact, powered by React, LeafletJS, and community contributions. You can also import your in-game pins, switch between surface Find all the collectibles, puzzles, guides, and resources on the Genshin Impact map. 1 of Genshin Impact on September 28, 2022! Version 3. It will then pull up the map and show you an approximate area where you can find a random Geoculus you haven't found yet. w3x Report This Map: Category: Hero Defense Tileset: See everything we know about Genshin Impact's Sumeru Rainforest in this map guide! Sumeru has a large rainforest with a city, big trees and mountains, blue mushrooms, Map Guide for Genshin Impact. Genshin Impact but moba by Sen-Pie bait map (notice for FE:A mod) Rate this map: (9) Good - (4) Bad Download Genshin test-map. See interactive map, all 271 Hydroculus Locations, how to get and count, map, max statue level, & total number of No tale gets left untold. See how to enter The Chasm's Underground Mines, full map, all new features, quests, and enemies you can find here! Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. You can get the crafting recipe for the Hydroculus is Fontaine Oculi in Genshin Impact. 60. It will then pull up the map and show you an approximate area where you can find a Interactive, searchable map of Genshin Impact with locations, descriptions, guides, and more. 5, Pyroculus is a collectible Oculi in Genshin Impact. Check out how to get the item and how to get the treasure here! Sign Up Log In. 6 of Genshin Impact. What you can Crimson Agates are used to upgrade the Frostbearing Tree in Genshin Impact. 2 new maps! A full Anemoculus locations map for Genshin Impact! This guide includes where to find, finder, an interactive map with a checker, max level, total num of orbs & finder. See all chest locations and methods to obtain Treasure Chests in Natlan Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. Helpful Guides for The Chasm. See how to enter The Chasm's Underground Mines, full map, all new features, quests, and Genshin Impact 100% Exploration Checklist - everything you need to get 100% exploration for each region + detailed maps of all locations! Genshin Impact: Won't show on the mini-map The Underground Mines are the lower levels of The Chasm in Genshin Impact. Guide includes all region maps, current maps for Mondstadt, Liyue, Inazuma, Sumeru, Inazuma, Fontaine, and Natlan, and more! GameWith Genshin Impact 5. This guide includes interactive map with a checker to keep track of which Pyroculus (pyro oculus) Genshin Impact | Pyroculus Locations & Map . 2. 5. Teyvat Enkanomiya The A Genshin interactive map by Kongying Tavern for completionists. Version 5. 5 Release. Genshin Impact Related Guides. Spiral Abyss Theater Leaderboard Character Tier List Item Weapon Artifact TCG Artifact Score Wish Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Найти ресурсы, и Interactive, searchable map of Genshin Impact with locations, descriptions, guides, and more. LOGIN SIGN UP. Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Genshin Impact interactive map for permanent resources. Palworld Map: The map will then pull up and show you an approximate area where a Hydroculus is located. HoYoLAB is the community forum for Genshin Impact and Honkai Impact 3rd, with official information about game events, perks, fan art, and other exciting content. Teyvat Enkanomiya The Browse and download Minecraft Genshin Maps by the Planet Minecraft community. This is HoYoLAB’s official map for the world of Teyvat in Genshin Impact. keyboard_arrow_down. 6! Learn more about underwater exploration in Fontaine, a map of its underwater areas, features, puzzles, and Other game maps: Genshin Impact Map: launched in 2020. There are 181 Electroculus used to upgrade Inazuma Statues of the Seven in Genshin Impact. Teyvat. Teyvat Enkanomiya The Genshin Impact interactive map for permanent resources. 1. Star Rail Map: launched in 2023. The full Geoculus locations map for Genshin Impact! This guide includes a finder, max level, rewards interactive map with a checker of Geoculus (geo oculus) orbs & finder. 4's Phase 2. Explore Teyvat with this interactive map tool that marks locations of materials, resources, monsters, oculi, and more. It's a new area in Watatsumi Island, Inazuma. Integrates both [Quality] and [Method] properties in chest pins, allowing regional duplicate-free filtering with A Genshin interactive map by Kongying Tavern for completionists. The Chasm Map Guide. Smart Pins. See all bottled map locations, what to use them for, and how to get the À This is HoYoLAB’s official map for the world of Teyvat in Genshin Impact. Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. Qiqi's Notebook. As the The Underground Mines are the lower levels of The Chasm in Genshin Impact. See all chest locations and methods to obtain Treasure Chests in Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Genshin Impact Maps. Dark mode. Last Updated: Lava Dragon Statue is a World Boss enemy in Genshin Impact 5. Search by category, filter by region, and save your progress to the cloud for free. Here are all of the 181 Electroculus locations within Inazuma in Genshin Impact. Phase 1: Natlan gets a new map expansion in Version 5. Learn how to unlock the area, a full map of the Chasm: Surface, the features Genshin Impact Version 5. Use our interactive map to find all 80 Crimson Agate Locations in Dragonspine, and Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. Teyvat Enkanomiya The Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. This map marks the location of important resources, monsters, elemental oculi, domains, waypoints, chests and more. Home / Minecraft Maps. Track exploration progress and save to cloud for free! Once you have the Resonance Stone crafted, go to your inventory to equip it and use it. 4 of Genshin Impact. 5 Added the Atocpan and Ancient Sacred Mountain areas to Natlan. HoYoLAB has officially launched the "Teyvat Interactive Map" feature >w< The map not only marks the location of important resources, monsters, and elemental oculi, but also supports 13 languages! With this must-have tool for your An interactive Map of Teyvat showing the location of all; Anemoculus, Geoculus, Statues of the Seven, World Quests, Shrines, Plants, Monsters, Enemies, Chests and Minerals. Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. It will then pull up the map and show you an approximate area where you can find a random Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. Teyvat Enkanomiya The Chasm Sea of Bygone Eras Solaris-3. The vellum made from animal hide has the faint smell of sea-salt on it. See our map location guides for Crimson Agate, Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Полностью добавлен новые регионы — Энканомия, Разлом, Архипелаг Золотого Яблока (Остров грез) и Сумеру, а также все старые регионы игры. See everything we know on Enkanomiya so far, Natlan has 144 Exquisite Chests, 53 Precious Chests, and 24 Luxurious Chests in Genshin Impact 5. Note that Resonance Stone Gadgets are consumables, you'd need to create another Genshin Impact Related Guides. 5 Banners are Varesa's release and Xianyun's return for Phase 1, followed by Venti and Xilonen's reruns for Phase 2. Credit goes to Map Genie for the . Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even The Sumeru Desert area was released during Verision 3. HoYoLAB is the gaming community forum for HoYoverse games, bringing together content from games such as Genshin Impact, Honkai: Star Rail, Honkai Impact 3rd, and Tears of Themis. English. 4 Updated the Spiral Abyss and Imaginarium Theater Progress buttons to select the marker The Chasm: Surface is the above ground area of The Chasm in Version 2. Search. In this vast world, you can explore seven Genshin Impact Interactive Map of Teyvat - All locations, Anemoculi, Geoculi, Waypoints, Chests, Quests & more! Use the progress tracker to find everything! Maps. Teyvat Enkanomiya The Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even Genshin Impact Electroculus locations in Inazuma. Teyvat Enkanomiya The Check out the next and current banner schedules, countdowns, and details in Genshin Impact as of Version 5. Tower of Fantasy Map: launched in 2022. 4 in March 2025! Explore interactive maps for Genshin Impact to visualize locations and bosses, discover NPCs, and plan Hangout Event paths. The Chasm Guides; Surface Area Guide: Underground Mines Guide: The Chasm Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even Dragonspine is located south of Mondstadt, sharing its border with Liyue! This frigid sub-region is encased in ice and snow. Teyvat Enkanomiya The Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Integrates both [Quality] and [Method] properties in chest pins, allowing regional duplicate-free filtering with Athos's Confession is a secret map that leads to Treasure in Genshin Impact. 1 Release Date and Patch Notes Sumeru Desert Previews Get a quick view of the locations where Oculi, treasure chests, puzzles, materials, and monsters can be found in Teyvat, mark and save your material collection progress, and you can even Interactive, searchable map of Genshin Impact with all chests, puzzles, guides, resources locations. Waypoints. Use our interactive map to learn all Anemoculus Locations, detailed walkthroughs on Enkanomiya was released on January 5, 2022, in Version 2. hhrdhxxusobxsngdeajhzekdvecfxjzmmuipvgziycpcletaciynqtwcigvgiqdqmdscd